PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G137600.2.p
Common NamePRUPE_ppa001704mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 687aa    MW: 74181.7 Da    PI: 8.1128
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G137600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.21.5e-30104188187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW++qe+laL+++r+em+ ++r++ lk+plWe+vs+k++e g++rs+k+Ckek+en++k+yk++keg+ +r++++s  +++f++lea
  Prupe.5G137600.2.p 104 RWPRQETLALLKIRSEMDVSFRDATLKGPLWEDVSRKLAELGYKRSAKKCKEKFENVHKYYKRTKEGRAGRQDGKS--YKFFSELEA 188
                         8*********************************************************************866665..******985 PP

2trihelix107.49.7e-34500585187
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                         rW+k evlaLi++r+ +e+r++++  k+plWee+s+ m + g++rs+k+Ckekwen+nk++kk+ke++kkr +e+ +tcpyf++l+a
  Prupe.5G137600.2.p 500 RWPKAEVLALIKLRSGLESRYQEAGPKGPLWEEISAGMGRMGYKRSSKRCKEKWENINKYFKKVKESNKKR-PEDAKTCPYFHELDA 585
                         8*********************************************************************8.99999********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.002101163IPR001005SANT/Myb domain
CDDcd122031.30E-27103168No hitNo description
PfamPF138379.0E-22103189No hitNo description
PROSITE profilePS500906.76103161IPR017877Myb-like domain
PROSITE profilePS500906.922493557IPR017877Myb-like domain
SMARTSM007170.0024497559IPR001005SANT/Myb domain
PfamPF138374.2E-23499586No hitNo description
CDDcd122032.77E-30499564No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0009414Biological Processresponse to water deprivation
GO:0010090Biological Processtrichome morphogenesis
GO:0030308Biological Processnegative regulation of cell growth
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000037Biological Processregulation of stomatal complex patterning
GO:2000038Biological Processregulation of stomatal complex development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MQQGAGGAQT HYGVGAAEDM GASAAAAAAG PSSSMAAAAA EAGDQAQLVE AASPISSRPP  60
ASASVNLDEL MTLSGAAAAA EDALAASRDE ADRGGGGVGS SGNRWPRQET LALLKIRSEM  120
DVSFRDATLK GPLWEDVSRK LAELGYKRSA KKCKEKFENV HKYYKRTKEG RAGRQDGKSY  180
KFFSELEALH GTTAATSSVN VSASPSIHVT HASPNPVSIG FSNPMPISSF RMSPTIPVMP  240
SQQPPATFPV MPSSQPPQTA ATTATPMDIN FSSNSSSSSP GTDDEDDDDD VEGEPSSRKR  300
KRGGASTSGS GSTRKMMEFF EVLMKQVMQK QETMQQRFLE VIEKREQDRT IREEAWKRQE  360
MARLTREHEL MSQERAISAS RDAAIISFLQ KITGQTIQLP PPVNVHSAPP PPVPPSVPVV  420
TPLAQQSVQP PIQTSYHQTT PQQQQPPQQQ HGQQVRHHQQ QSQNLQVVMA VPEQQVQPPQ  480
ENIASGGGAG GSLEPASSSR WPKAEVLALI KLRSGLESRY QEAGPKGPLW EEISAGMGRM  540
GYKRSSKRCK EKWENINKYF KKVKESNKKR PEDAKTCPYF HELDALYRKR ILGGGGGGGS  600
SSSLGNQNRL EQPQQHQLQL ENPKSDSATQ PQDRSLEAQP SVPVMPQTQE AVVATDQSEN  660
KNGDQSANVE NLFGEATDEA AKKKTL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154KRSAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007210347.10.0hypothetical protein PRUPE_ppa001704mg
TrEMBLM5WE170.0M5WE17_PRUPE; Uncharacterized protein
STRINGSi034382m1e-162(Setaria italica)
STRINGSb01g049740.11e-163(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.13e-49Trihelix family protein